PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 351aa    MW: 39860.4 Da    PI: 4.6831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621617.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
   XP_009621617.1 14 RGRWTEEEDEILTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding43.86.1e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+ E+ +++++ + lG++ W++Ia++++ gRt++++k++w++
   XP_009621617.1  67 RGNITAAEEAIIIKLRATLGNR-WSLIAEYLP-GRTDNEIKNYWNS 110
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.501961IPR017930Myb domain
SuperFamilySSF466891.54E-2711108IPR009057Homeodomain-like
SMARTSM007179.4E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001671.45E-81661No hitNo description
PROSITE profilePS5129422.19262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2265116IPR009057Homeodomain-like
SMARTSM007171.7E-1466114IPR001005SANT/Myb domain
PfamPF002491.6E-1267110IPR001005SANT/Myb domain
CDDcd001676.16E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRTPCCEKV GLKRGRWTEE EDEILTKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LKTDLKRGNI TAAEEAIIIK LRATLGNRWS LIAEYLPGRT DNEIKNYWNS RLSRKVESLR  120
IPSDEKLPQA VVELAKKGTQ QLNKQRRRRT SPSSKSIASN LSKPDHPVAE SEFSSNETIV  180
PIPSTPNIEK EALSSTINIT NTSSQECGNN IIASGNNIAI ELDNDQMHWR DGIVLMDENE  240
ELGQDFIFSC LWNGEGENFE IVENNNNNKI LLSEDDKIIV SDETKTFMGD WEYLWASEEA  300
EQENNMSNNN HLSSWPLWDS NDTAGLQQNS TNEAMVEIDY HHSDLVAWLL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754514e-52HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621617.10.0PREDICTED: transcription factor MYB12-like
TrEMBLM1AB811e-110M1AB81_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000188411e-109(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-68myb domain protein 111